Loading... Please wait...
  • My Account
  • Order Status
  • Wish Lists

TNFR Human, His

Price:
$93.00
SKU:
PS-CYT-673-5UG
Quantity:

TNFR Human, His

(Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.)

TNFR1 belongs to the TNF-receptor superfamily. TNFR1 is a receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. There are 2 types of soluble TNF receptors: sTNFR-I and sTNFR-II, which act to neutralize the biological activities of TNF alpha and TNF beta. The levels of these soluble receptors seem to increase as a result of shedding of the extracellular domains of the membrane bound receptors. TNF-a, TNFR1 and TNFR2 have roles in cellular differentiation. TNFR1 and TNFR2 function in cell type-specific renal injury. TNFR1 is capable of signaling both cell survival and apoptosis. TNFR1-induced apoptosis requires 2 sequential signaling complexes. TNFR1 is capable of activating NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, ligand-independent and enhanced ligand-dependent TNF signaling. TNFR1 contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase. Human TNFR1 has a major region which controls cell surface expression. High levels of soluble TNF receptors are found in the amniotic fluid of pregnant women. Germline mutations of the extracellular domains of TNFR1 are linked to the autosomal dominant periodic fever syndrome. The impaired receptor clearance is believed to be a mechanism of the disease. Familial hibernian fever (FHF) is caused by defects in TNFRSF1A gene.

TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.

Purity: Greater than 95.0% as determined by SDS-PAGE.

Source: Escherichia Coli.

Physical Appearance: Sterile Filtered clear solution.

Formulation: TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.

TNFR General Information

Amino acid sequence:
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQ DTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVE ISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCL NGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKK SLECTKLCLPQIEN.

Storage:
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.

Free Shipping within the Continental USA

Add to Wish List

Click the button below to add the TNFR Human, His to your wish list.

Let's Stay in Touch


Recently Viewed...


logos of accepted credit card companies: visa, mastercard, discover and american expesss

Terms of Service & Privacy Policy | Sitemap | P212121 Company Information | Accessibility Statement

Products are for research use only and are not intended for human use. We do not sell to patients or the public. Buyers must be employeed by scientific research companies or universities.

WARNING: Products sold can expose you to chemicals including lead, which is known to the State of California to cause cancer, birth defects, and/or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

All prices are in USD Copyright 2025 P212121, LLC.