Loading... Please wait...
  • My Account
  • Order Status
  • Wish Lists

Chitinase

Price:
$207.00
Quantity:

Chitinase

Chitinase is a digestive enzyme which breaks down glycosidic bonds in chitin. Due to chitin being a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods), chitinases are usually found in organisms that either need to remake their own chitin or to dissolve and digest the chitin of fungi or animals. Chitinivorous organisms include many bacteria genuses such as Aeromonas, Bacillus, Vibrio, among others, which may be pathogenic or detritivorous. Chitinase expression is mediated by the NPR1 gene and the salicylic acid pathway, both of which are involved in resisting fungal and insect attack. Human chitinases appear in gastric juices. They are likely to be digestive chitinases, for catabolic activity. Chitinase activity is identified systemically in humans, in the blood, and possibly cartilage. Chitinase has been related to allergies, asthma in particular has been linked to enhanced chitinase expression levels, also dust mites and mold spores which are both chitin covered.

Chitinase Clostridium Paraputrificum Recombinant fused with a 13 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 583 amino acids and having a molecular mass of 64.3kDa. The Chitinase is purified by proprietary chromatographic techniques.

Purity: Greater than 95.0% as determined by SDS-PAGE.

Source: Escherichia Coli.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Chitinase lyophilized from a 0.2µm filtered concentrated solution in PBS.

Chitinase General Information

Amino acid sequence:
HMRGSGSHHHHHHMYYGDWSIWGGQGNFYPKDIPADKLTHLNFAFMDFNSSGEL IYCDKDAAIGHPLGNLGVTYGDVNGGILNAFQVLKSENPNLKIGVSLGGWSKSG DFSTIAATPSIRAKFVENVMKFIKYTNMDFVDIDWEYPGDYREPDKTDNINDEG TPNASAGDKENYILLLQDLKEALNKQGKELGKVYELSVALPAGVSKIEKGIDVD KLFNIVDFANIMTYDMAGAWSTTSGHQTALYTNPNAPEEYKGLSVDESVKYYIS QGAEREKIVVGAAYYTRGWEQVSDKGTDPNNPGLFGEAAVVNKDADLSPTPGAL NEAPMKNGEGGRAGGVWGYNALDKLKSKYTGLKEYWDDSAKAPYLYNSETGAFF TYDNIRSIQEKAKYVKENNLGGIIGWMASQDATTNSTKRDELTTATKESLFGKE DLPKYEIKYTENDITCTVTPVKQSWGSGGVLKMSITNNEKLDESGEVLSTVETS AKTVKNMKVYIKTDGIAITGSQYPAGPVTKEGDYYVIDFGKISDGKLMKAGITF TFDLNLDKAIEDTNNIISIEVSQRMYQTSPEFNRQTIWENTNS.

Storage:
Lyophilized Chitinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Chitinase should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Free Shipping within the Continental USA

Add to Wish List

Click the button below to add the Chitinase to your wish list.

Let's Stay in Touch


Recently Viewed...


logos of accepted credit card companies: visa, mastercard, discover and american expesss

Terms of Service & Privacy Policy | Sitemap | P212121 Company Information | Accessibility Statement

Products are for research use only and are not intended for human use. We do not sell to patients or the public. Buyers must be employeed by scientific research companies or universities.

WARNING: Products sold can expose you to chemicals including lead, which is known to the State of California to cause cancer, birth defects, and/or other reproductive harm. For more information, go to www.P65Warnings.ca.gov.

All prices are in USD Copyright 2026 P212121, LLC.